HIV-specific cytotoxic T-cell responses |
| OF INVENTION The inventors have found that two nanomer peptides, designated CLP-177 (SEQ ID NO:2) ... |
|
Susceptibility mutation for breast and ovarian cancer |
| OF THE PREFERRED EMBODIMENTS The present invention is based on the discovery of a two base pair ... |
|
Avirulent herpetic viruses useful as tumoricidal agents and vaccines |
| The present invention provides a herpetic virus selected from the group consisting of neurotrophic ... |
|
Attachment enhanced 293 cells |
| In one aspect, the invention provides improved HEK 293 cells, which cells are 293 cells which have ... |
|
Method for the production of polypeptides |
| The above identified purpose is achieved with the method according to the present invention which ... |
|
DNA sequences coding for a protein conferring male sterility |
| Thus, in a first aspect the present invention provides recombinant or isolated Nucleic acid which: ... |
|
Tumor associated nucleic acids and uses therefor |
| OF THE INVENTION The examples which follow show the isolation of nucleic acid molecules which code ... |
|
Mad-related genes in the human |
| It is an object of the invention to provide a cDNA of the human Smad2 gene. It is another object of ... |
|
|
Immunologically active proteins from Borrelia burgdorferi, nucleic acids which encode them, and their use in test kits and as vaccines
| Details |
Inventors: Motz, Manfred; Soutschek, Erwin;
Assignee: Mikrogen Molekularbiologische Entwicklungs - GmbH (Munich, DE)
Primary Examiner: Swartz; Rodney P
Assistant Examiner:
Attorney, Agent or Firm: Schwegman, Lundberg, Woessner & Kluth, P.A.
The present invention relates to immunologically active proteins from Borrelia burgdorferi which are present in a form which is free of other proteins derived from Borrelia burgdorferi and which exhibit the sequence of the protein 1829-22A, which has the amino acid sequence MKKFNLIIEALFAILLTACNFGLMEETKIALESSSKDVKNKILQIKKDAEDKGVNFAAFTSSETG SKVTNGGLALREAKIQAINEVEKFLKRIEEEALKLKEHGNSGQFLELFDLLLEVLESLEPIGIKG LKDFISEEAKCNPISTSERLIEVKVQIENKMEEVKRKQNLNKERKSNKGKKKK SEQ. ID NO.: 1 or a part sequence thereof having at least 10 consecutive amino acids, or exhibit the sequence of the protein 1829-22B, which has the amino acid sequence MIKYNKIILTLTLLASLLAACSLTGKARLESSVKDITNEIEKAIKEAEDAGVKTDAFTETQTGGK VAGPKIRAAKIRVADLTIKFLEATEEETITFKENGAGEDEFSGIYDLILNAAKAVEKIGMKDMTK TVEEAAKENPKTTANGIIEIVKVMKAKVENIKEKQTKNQK SEQ. ID NO.: 2 or a part sequence thereof having at least 10 consecutive amino acids. |
|
DETAILED DESCRIPTION What is claimed is: 1. An immunologically active Borrelia burgdorferi protein free of other proteins isolated from Borrelia burgdorferi, which protein comprises SEQ ID NO: 1, or at least 25 consecutive amino acids of SEQ ID NO:1, or SEQ ID NO: 2, or at least 10 amino acids of SEQ ID NO:2, or at least 25 consecutive amino acids of SEQ ID NO:2. 2. An immunologically active protein as claimed in claim 1 comprising at least 50 consecutive amino acids of SEQ ID NO:1 or at least 50 consecutive amino acids of SEQ ID NO:2. 3. An ELISA test kit for detecting an antibody against a Borrelia strain, comprising at least one immunologically active protein as claimed in claim 2 which is able to bind with the antibody; and a reporter component which makes it possible to detect a complex consisting of said immunologically active protein and the antibody, wherein at least one immunologically active protein as claimed in claim 3 is coupled to microtiter plates, and the reporter component consists of anti-human immunoglobulin, in particular anti-IgG and/or anti-IgM antibodies to which an enzyme which catalyzes a color reaction is coupled. 4. A test kit for detecting an antibody against a Borrelia strain, comprising at least one immunologically active protein as claimed in claim 1 which is able to bind with the antibody, and a reporter component which makes it possible to detect a complex consisting of said immunologically active protein and antibody. 5. A test kit as claimed in claim 4, wherein at least one immunologically active protein has at least 25 consecutive amino acids of SEQ ID NO:1 and at least one immunologically active protein has at least 10 amino acids of SEQ ID NO:2. 6. A test kit as claimed in claim 4, wherein the reporter component is a reporter antibody exhibiting a label, wherein the reporter antibody binds with an antibody against a Borrelia strain. 7. A test kit as claimed in claim 6, wherein the reporter antibody is an anti-human IgG antibody or an anti-human IgM antibody
|
| Related patents |
|
|
Immunoliposomes that optimize internalization into target cells
The present invention provides novel immunoliposomes optimized for delivering therapeutic agents to the cytoplasm of a target cell. These immunoliposomes exhibit ...
|
|
|
Virus-like particles for the induction of autoantibodies
The inventors have discovered compositions and methods of increasing the titers of antibodies to tolerogens (e.g., self antigens and foreign antigens) over those titers ...
|
|
|
Ferritin analogs
Despite the fact that ferritin is extremely selective in accumulating, storing and dispensing iron in living things, I have discovered that the forgoing objectives can ...
|
|
|
Methods of treatment using anti-ErbB antibody-maytansinoid conjugates
What is claimed is: 1. A method for the treatment of a tumor in a mammal, comprising the steps of (i) identifying said tumor as being characterized by overexpression of ...
|
|
|
Methods for diagnosing early Lyme disease
This invention is based upon the discovery that sera from patients with early Lyme disease contain predominant IgM reactivity to a major 23 kDa protein (p23; also ...
|
|
|
Tango 243 polypeptides and uses thereof
The present invention is based, at least in part, on the discovery of cDNA molecules which encode the TANGO 228, 240, and 243 proteins, all of which are either wholly ...
|
|
|
Dermatophagoides proteins and fragments thereof
What is claimed is: 1. An isolated protein comprising an amino acid sequence selected from the group consisting of SEQ ID NO:15, SEQ ID NO:18 and SEQ ID NO:21. 2. A ...
|
|
|
Tuberculin active proteins and peptides from the cells of tubercle bacilli
What is claimed is: 1. A tuberculin active simple protein from Mycobacterium tuberculosis strain Aoyama B which is characterized by the following amino acid sequence: ##E...
|
|
|
Therapy for injured muscles
We claim: 1. A method for treating an injured muscle, the method comprising the step of local administration of a therapeutically effective amount of a botulinum toxin ...
|
|
|
Secreted and transmembrane polypeptides and nucleic acids encoding the same
1. PRO1560 A cDNA clone (DNA19902-1669) has been identified that encodes a novel polypeptide believed to be a novel member of the tetraspan family, designated in the ...
|
|
|